PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015866302.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 221aa    MW: 24186.4 Da    PI: 8.3625
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015866302.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.92.9e-401676262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    ++++lkcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG+lrn+PvGgg+rkn k+s
  XP_015866302.1 16 EQEQLKCPRCESTNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGTLRNIPVGGGSRKNTKRS 76
                    57899****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-261168IPR003851Zinc finger, Dof-type
PfamPF027011.7E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3292074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MQDSATFQPV KPHFPEQEQL KCPRCESTNT KFCYYNNYNL SQPRHFCKNC RRYWTKGGTL  60
RNIPVGGGSR KNTKRSSNQK RSSSSSSSTS TSVSNSAQHN SDQQPDPTPI YSHTVDTDRR  120
MLDIPGSFSS LLTSNGQFGS LLEGLNPNVS GVKMVQLGEF GENLNSGIQL NSESGRTQGM  180
DVQGNSNSES YLGMQNGDSS CWGGGNGWPD LAIYTPGSSF Q
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6629139e-52KP662913.1 Cajanus cajan Dof19 (Dof19) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015866302.11e-163PREDICTED: dof zinc finger protein DOF3.1-like
SwissprotO821551e-45DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLM5WV641e-104M5WV64_PRUPE; Uncharacterized protein
STRINGVIT_09s0002g02490.t012e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61813351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.16e-39DOF zinc finger protein 1